PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.197670.1
Common NameCsa_1G009700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 306aa    MW: 34668.5 Da    PI: 9.4904
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.197670.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.82.5e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++q+G+g+W+++++  g+ R+ k+c++rw +yl
   Cucsa.197670.1 15 KGPWTPEEDIILVSYIHQHGPGNWRSVPNNTGLLRCSKSCRLRWTNYL 62
                     79******************************99************97 PP

2Myb_DNA-binding45.41.9e-1468113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++ +E+  +v++ ++lG++ W++Ia++++  Rt++++k++w+++l
   Cucsa.197670.1  68 RGGFSDDEENMIVHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 113
                      7889******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.5121066IPR017930Myb domain
SuperFamilySSF466894.49E-2913109IPR009057Homeodomain-like
SMARTSM007171.2E-141464IPR001005SANT/Myb domain
PfamPF002491.0E-161562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-221669IPR009057Homeodomain-like
CDDcd001676.35E-111762No hitNo description
SMARTSM007174.6E-1467115IPR001005SANT/Myb domain
PROSITE profilePS5129418.97467117IPR017930Myb domain
PfamPF002492.9E-1368113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-2370116IPR009057Homeodomain-like
CDDcd001671.55E-971113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MGRPPCCSQT IAVKKGPWTP EEDIILVSYI HQHGPGNWRS VPNNTGLLRC SKSCRLRWTN  60
YLRPGIKRGG FSDDEENMIV HLQALLGNRW AAIASYLPQR TDNDIKNYWN THLKKKAQIR  120
GQWERRLQTD IQTAKQALRE ALSLTTKKDF IQNKLLLLSS SPPNKNNNKQ FHISSSSSSP  180
STSSSSSSST YVSNAENIAE LLKNWTKNSP KKAMARSRNS ESSSSCQNNN NNNNTNCSNL  240
WVEEEISYYS NNNNNNVQEG GVPFNLLEKW LFDEAAPTPQ YHPQYQNDHF LNLSLQDSQT  300
PFSFN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-241511727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818131e-155LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBankLN7132561e-155LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008453202.11e-161PREDICTED: myb-related protein 306-like
SwissprotP813928e-94MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0A0LUH30.0A0A0A0LUH3_CUCSA; Uncharacterized protein
STRINGGLYMA04G33720.11e-100(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.16e-84myb domain protein 30
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]